Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cul4b Peptide - C-terminal region

Cul4b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2700050M05Rik, AA409770, KIAA0695, mKIAA0695, CUL-4B

UniProt

A2A432

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cul4b Rabbit Polyclonal Antibody (orb585205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103612

Preservative

Lyophilized powder

AA Sequence

IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CCL18/PARC Antibody (64507) [FITC]
FAB394F 0.1 mL

Mouse Monoclonal CCL18/PARC Antibody (64507) [FITC]

Sign In for Pricing
View Details
Oxybenzone
B4737-5.1 10 mM (in 1mL DMSO)

Oxybenzone

Sign In for Pricing
View Details
FEM 1B Rabbit Polyclonal Antibody (Cy5.5)
orb1039635 100 µL

FEM 1B Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
5-Bromo-2-[ (3,4-dichlorobenzyl) oxy]benzoic acid
sc-318292 500 mg

5-Bromo-2-[ (3,4-dichlorobenzyl) oxy]benzoic acid

Sign In for Pricing
View Details
IMMP1L sgRNA CRISPR Lentivector (Human) (Target 1)
K1084402 1.0 µg DNA

IMMP1L sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CENPK Rabbit pAb
E45R27555N-50 50 µL

CENPK Rabbit pAb

Sign In for Pricing
View Details