Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cul4b Peptide - C-terminal region

Cul4b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2700050M05Rik, AA409770, KIAA0695, mKIAA0695, CUL-4B

UniProt

A2A432

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cul4b Rabbit Polyclonal Antibody (orb585205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103612

Preservative

Lyophilized powder

AA Sequence

IQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKS6 siRNA (Mouse)
MBS8208872-01 15 nmol

ANKS6 siRNA (Mouse)

Sign In for Pricing
View Details
ANKS6 siRNA (Mouse)
MBS8208872-02 30 nmol

ANKS6 siRNA (Mouse)

Sign In for Pricing
View Details
ANKS6 siRNA (Mouse)
MBS8208872-03 5x 30 nmol

ANKS6 siRNA (Mouse)

Sign In for Pricing
View Details
SNRNP48 Protein Vector (Human) (pPM-C-His)
PV058164 500 ng

SNRNP48 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Chicken Alanine Aminotransferase (ALT) ELISA Kit
orb782529-01 48 Tests

Chicken Alanine Aminotransferase (ALT) ELISA Kit

Sign In for Pricing
View Details
Chicken Alanine Aminotransferase (ALT) ELISA Kit
orb782529-02 96 Tests

Chicken Alanine Aminotransferase (ALT) ELISA Kit

Sign In for Pricing
View Details