Pacsin3 Peptide - C-terminal region
Pacsin3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
4921507A02Rik, 6330413E15Rik, AW413130
UniProt
Q99JB8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pacsin3 Rabbit Polyclonal Antibody (orb331169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_083009
Preservative
Lyophilized powder
AA Sequence
GPGMAMNWPQFEEWSLDTQRAISRKEKGGRSPDEVTLTSIVPTRDGTAPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1135-100mg 100 mg
Anti-Mouse IFN Alpha (TIF-3C5) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details ![SIRT5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 1G9]](https://cdn.genprice.uk/products/937/6868c34d994c49e6dc3f37b0/imageurl/ta503279am.webp)
TA503279AM 100 µL
SIRT5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 1G9]
Sign In for Pricing
View Details 
BNUB1730-100 1x 100 µL
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), 0.2mg/mL
Sign In for Pricing
View Details 
