Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif3k Peptide - N-terminal region

Eif3k Peptide - N-terminal region

Product Specifications

Product Name Alternative

1200009C21Rik, Eif3s12

UniProt

Q9DBZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif3k Rabbit Polyclonal Antibody (orb331175) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082935

Preservative

Lyophilized powder

AA Sequence

QILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E. coli zwf protein
orb245715-01 20 µg

E. coli zwf protein

Sign In for Pricing
View Details
E. coli zwf protein
orb245715-02 100 µg

E. coli zwf protein

Sign In for Pricing
View Details
E. coli zwf protein
orb245715-03 1 mg

E. coli zwf protein

Sign In for Pricing
View Details
SUCLA2/Renal carcinoma antigen NYREN39 Rabbit Polyclonal Antibody
orb313208-01 50 μL

SUCLA2/Renal carcinoma antigen NYREN39 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SUCLA2/Renal carcinoma antigen NYREN39 Rabbit Polyclonal Antibody
orb313208-02 100 µL

SUCLA2/Renal carcinoma antigen NYREN39 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SUCLA2/Renal carcinoma antigen NYREN39 Rabbit Polyclonal Antibody
orb313208-03 200 µL

SUCLA2/Renal carcinoma antigen NYREN39 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details