Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif3k Peptide - N-terminal region

Eif3k Peptide - N-terminal region

Product Specifications

Product Name Alternative

1200009C21Rik, Eif3s12

UniProt

Q9DBZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif3k Rabbit Polyclonal Antibody (orb331175) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082935

Preservative

Lyophilized powder

AA Sequence

QILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Acimtamig
DHD80910 100 μg

Research Grade Acimtamig

Sign In for Pricing
View Details
(-)-Chlorpheniramine maleate
T23572-01 10 mg

(-)-Chlorpheniramine maleate

Sign In for Pricing
View Details
(-)-Chlorpheniramine maleate
T23572-02 1 g

(-)-Chlorpheniramine maleate

Sign In for Pricing
View Details
(-)-Chlorpheniramine maleate
T23572-03 1 mg

(-)-Chlorpheniramine maleate

Sign In for Pricing
View Details
(-)-Chlorpheniramine maleate
T23572-04 50 mg

(-)-Chlorpheniramine maleate

Sign In for Pricing
View Details
(-)-Chlorpheniramine maleate
T23572-05 5 mg

(-)-Chlorpheniramine maleate

Sign In for Pricing
View Details