Faf2 Peptide - N-terminal region
Faf2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2210404D11Rik, AI462440, Ubxd8, mKIAA0887
UniProt
Q3TDN2
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Faf2 Rabbit Polyclonal Antibody (orb326419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_848484
Preservative
Lyophilized powder
AA Sequence
LLQFQDLTGIESMEQCRLALEQHNWNMEAAVQDRLNEQEGVPSVFNPPPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881037-500 1x 500 µL
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details