Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif3d Peptide - N-terminal region

Eif3d Peptide - N-terminal region

Product Specifications

Product Name Alternative

Eif3s7, MGC93918

UniProt

Q6AYK8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif3d Rabbit Polyclonal Antibody (orb585320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004283

Preservative

Lyophilized powder

AA Sequence

SGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 Antibody / Melan-A
V5283SAF-100UG 100 µg

MART-1 Antibody / Melan-A

Sign In for Pricing
View Details
Phospho-c-Jun (Ser63) Antibody [E24K1]
F4072-100uL 100 µL

Phospho-c-Jun (Ser63) Antibody [E24K1]

Sign In for Pricing
View Details
Bevacizumab (anti-VEGF)
C00007-1mg*5 5x 1mg

Bevacizumab (anti-VEGF)

Sign In for Pricing
View Details
RINT1 (RAD50-interacting Protein 1, RAD50 Interactor 1, HsRINT-1, RINT-1)
132592 50 µg

RINT1 (RAD50-interacting Protein 1, RAD50 Interactor 1, HsRINT-1, RINT-1)

Sign In for Pricing
View Details
SAE1 siRNA (Rat)
CRR5135-01 15 nmol

SAE1 siRNA (Rat)

Sign In for Pricing
View Details
SAE1 siRNA (Rat)
CRR5135-02 30 nmol

SAE1 siRNA (Rat)

Sign In for Pricing
View Details