Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUGCT Peptide - C-terminal region

SUGCT Peptide - C-terminal region

Product Specifications

Product Name Alternative

D17907, 5033411D12Rik

UniProt

G3X9F8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUGCT Rabbit Polyclonal Antibody (orb326430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619595

Preservative

Lyophilized powder

AA Sequence

ANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoro-4-hydroxyphenylboronic acid
TRC-F595328-250MG 250 mg

2-Fluoro-4-hydroxyphenylboronic acid

Sign In for Pricing
View Details
Betafluor
LS-151 4 L

Betafluor

Sign In for Pricing
View Details
RPL27AP6 Human Gene Knockout Kit (CRISPR)
KN402759 1 Kit

RPL27AP6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vmn2r110 Mouse Gene Knockout Kit (CRISPR)
KN519125 1 Kit

Vmn2r110 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HDAC4 Rabbit Polyclonal Antibody
AP06392PU-N 100 µg

HDAC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD11a Antibody[R7-1]
E-AB-F1211A-01 25 µg

Purified Anti-Human CD11a Antibody[R7-1]

Sign In for Pricing
View Details