SUGCT Peptide - C-terminal region
SUGCT Peptide - C-terminal region
Product Specifications
Product Name Alternative
D17907, 5033411D12Rik
UniProt
G3X9F8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SUGCT Rabbit Polyclonal Antibody (orb326430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_619595
Preservative
Lyophilized powder
AA Sequence
ANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MHC Class II I-Ad Mouse Monoclonal Antibody [Clone ID: 34-5-3S]](https://cdn.genprice.uk/products/937/68dd18bc061270361e90933e/imageurl/cl090f.webp)
CL090F 100 µg
MHC Class II I-Ad Mouse Monoclonal Antibody [Clone ID: 34-5-3S]
Sign In for Pricing
View Details 
![Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]](https://cdn.genprice.uk/products/937/68dd1b82061270361ea1ecb4/imageurl/ta809373am.webp)
TA809373AM 100 µL
Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]
Sign In for Pricing
View Details