Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc11 Peptide - C-terminal region

Dnajc11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

E030019A03Rik

UniProt

Q5U458

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc11 Rabbit Polyclonal Antibody (orb585363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766292

Preservative

Lyophilized powder

AA Sequence

RIIEAEESRMGLIIVNAWYGKFVNDKSRKNEKVKVIDVTVPLQCLVKDSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LRRC59 Antibody
MBS8291489-01 0.03 mL

Anti-LRRC59 Antibody

Sign In for Pricing
View Details
Anti-LRRC59 Antibody
MBS8291489-02 0.05 mL

Anti-LRRC59 Antibody

Sign In for Pricing
View Details
Anti-LRRC59 Antibody
MBS8291489-03 0.1 mL

Anti-LRRC59 Antibody

Sign In for Pricing
View Details
Anti-LRRC59 Antibody
MBS8291489-04 0.2 mL

Anti-LRRC59 Antibody

Sign In for Pricing
View Details
Anti-LRRC59 Antibody
MBS8291489-05 5x 0.2 mL

Anti-LRRC59 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM217 Antibody
NBP2-68982-25ul 25 µL

Rabbit Polyclonal TMEM217 Antibody

Sign In for Pricing
View Details