Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc11 Peptide - C-terminal region

Dnajc11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

E030019A03Rik

UniProt

Q5U458

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc11 Rabbit Polyclonal Antibody (orb585363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766292

Preservative

Lyophilized powder

AA Sequence

RIIEAEESRMGLIIVNAWYGKFVNDKSRKNEKVKVIDVTVPLQCLVKDSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PRPK Antibody [DyLight 405]
NBP2-99394V 0.1 mL

Rabbit Polyclonal PRPK Antibody [DyLight 405]

Sign In for Pricing
View Details
N- (t-Butyl ester-PEG3) -N-bis (PEG3-amine)
HY-W190955 1 Each

N- (t-Butyl ester-PEG3) -N-bis (PEG3-amine)

Sign In for Pricing
View Details
FAM160A1 (NM_001109977) Human Recombinant Protein
TP326307 20 µg

FAM160A1 (NM_001109977) Human Recombinant Protein

Sign In for Pricing
View Details
Psma2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6841606 1.0 µg DNA

Psma2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Simian ANP (Atrial Natriuretic Peptide) ELISA Kit
orb3126939-01 48 Tests

Simian ANP (Atrial Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Simian ANP (Atrial Natriuretic Peptide) ELISA Kit
orb3126939-02 96 Tests

Simian ANP (Atrial Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details