Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP14 Peptide - middle region

FKBP14 Peptide - middle region

Product Specifications

Product Name Alternative

FKBP22, FLJ20731

UniProt

Q9NWM8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FKBP14 Rabbit Polyclonal Antibody (orb585389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060416

Preservative

Lyophilized powder

AA Sequence

GLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Med6 (D-2) AC
sc-390474 AC 500 µg/mL - 25% ag

Med6 (D-2) AC

Sign In for Pricing
View Details
OR4A16 Protein Lysate (Human) with C-Ha Tag
35148031 100 µg

OR4A16 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MAP2K7 Rabbit Polyclonal Antibody (C-Term)
E28PB5010 100 µL

MAP2K7 Rabbit Polyclonal Antibody (C-Term)

Sign In for Pricing
View Details
S49076 hydrochloride
GW2276-10mg 10 mg

S49076 hydrochloride

Sign In for Pricing
View Details
Fexapotide triflutate
MBS5812937 Inquire

Fexapotide triflutate

Sign In for Pricing
View Details
(Tyr36) -pTH-Related Protein (1-36) amide (chicken)
M40399-01 100 mg

(Tyr36) -pTH-Related Protein (1-36) amide (chicken)

Sign In for Pricing
View Details