Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCR1 Peptide - C-terminal region

NCR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD335, FLJ99094, LY94, NK-p46, NKP46

UniProt

O76036

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCR1 Rabbit Polyclonal Antibody (orb585729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004820

Preservative

Lyophilized powder

AA Sequence

WDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Casein Beta (CSN2) ELISA Kit
RDR-CSN2-Hu-01 96 Tests

Human Casein Beta (CSN2) ELISA Kit

Sign In for Pricing
View Details
Human Casein Beta (CSN2) ELISA Kit
RDR-CSN2-Hu-02 48 Tests

Human Casein Beta (CSN2) ELISA Kit

Sign In for Pricing
View Details
NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody
AP02558PU-N 100 µL

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Crystallin Alpha B (CPTC-CRYAB-1), 0.2mg/mL
BNUB2235-500 1x 500 µL

Crystallin Alpha B (CPTC-CRYAB-1), 0.2mg/mL

Sign In for Pricing
View Details
Human FSIP1 activation kit by CRISPRa
GA116036 1 Kit

Human FSIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mucin 5AC Antibody
KC-24973-01 50 μL

Mucin 5AC Antibody

Sign In for Pricing
View Details