Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp109 Peptide - C-terminal region

Zfp109 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC141452

UniProt

Q9R166

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp109 Rabbit Polyclonal Antibody (orb576675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064658

Preservative

Lyophilized powder

AA Sequence

CWECGKGFSQPSLFERHRRVHTGERPYICGTCCKGFSQRSHLVKHQRVHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FTL Antibody Pair Set
E-KAB-0547 50 µL & 100 µg

Human FTL Antibody Pair Set

Sign In for Pricing
View Details
Octafluoro-4,4'-biphenol
TRC-O273108-100MG 100 mg

Octafluoro-4,4'-biphenol

Sign In for Pricing
View Details
Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit
E-EL-H2077-01 24 Tests

Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit

Sign In for Pricing
View Details
Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit
E-EL-H2077-02 48 Tests

Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit

Sign In for Pricing
View Details
Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit
E-EL-H2077-03 96 Tests

Human CYFRA21-1 (Cytokeratin Fragment Antigen 21-1) ELISA Kit

Sign In for Pricing
View Details
Recombinant SLC12A1 Antibody
RC-4665-01 50 μL

Recombinant SLC12A1 Antibody

Sign In for Pricing
View Details