Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp109 Peptide - C-terminal region

Zfp109 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC141452

UniProt

Q9R166

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp109 Rabbit Polyclonal Antibody (orb576675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064658

Preservative

Lyophilized powder

AA Sequence

CWECGKGFSQPSLFERHRRVHTGERPYICGTCCKGFSQRSHLVKHQRVHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP Polyclonal Antibody
E-AB-70040-01 60 µL

GFAP Polyclonal Antibody

Sign In for Pricing
View Details
GFAP Polyclonal Antibody
E-AB-70040-02 120 µL

GFAP Polyclonal Antibody

Sign In for Pricing
View Details
GFAP Polyclonal Antibody
E-AB-70040-03 200 µL

GFAP Polyclonal Antibody

Sign In for Pricing
View Details
Epalrestat-d5
TRC-E565302-5MG 5 mg

Epalrestat-d5

Sign In for Pricing
View Details
Recombinant LAMP2 Antibody
RC-5036-01 50 μL

Recombinant LAMP2 Antibody

Sign In for Pricing
View Details
Recombinant LAMP2 Antibody
RC-5036-02 100 µL

Recombinant LAMP2 Antibody

Sign In for Pricing
View Details