Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmg20b Peptide - middle region

Hmg20b Peptide - middle region

Product Specifications

UniProt

D4A586

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hmg20b Rabbit Polyclonal Antibody (orb576828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102201

Preservative

Lyophilized powder

AA Sequence

TKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pseudomonas aeruginosa serotype 6C (1200/472), CF405S conjugate, 0.1mg/mL
BNC040240-500 1x 500 µL

Pseudomonas aeruginosa serotype 6C (1200/472), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DDTL activation kit by CRISPRa
GA119063 1 Kit

Human DDTL activation kit by CRISPRa

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), CF405S conjugate, 0.1mg/mL
BNC041746-500 1x 500 µL

Human Herpes Virus 8 (HHV8) (LN53), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac 3,4-Dihydroxymandelic Acid
TRC-D453000-5G 5 g

rac 3,4-Dihydroxymandelic Acid

Sign In for Pricing
View Details
Human Hey L (HEYL) activation kit by CRISPRa
GA108880 1 Kit

Human Hey L (HEYL) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CD74 Protein (His Tag)
PKSH031262 100 µg

Recombinant Human CD74 Protein (His Tag)

Sign In for Pricing
View Details