Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmg20b Peptide - middle region

Hmg20b Peptide - middle region

Product Specifications

UniProt

D4A586

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hmg20b Rabbit Polyclonal Antibody (orb576828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102201

Preservative

Lyophilized powder

AA Sequence

TKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL3RB (CSF2RB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H3]
TA807897AM 100 µL

IL3RB (CSF2RB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H3]

Sign In for Pricing
View Details
1-Bromopentane
TRC-B686245-5G 5 g

1-Bromopentane

Sign In for Pricing
View Details
NFYA (NM_002505) Human Over-expression Lysate
LC400893 20 µg

NFYA (NM_002505) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PARK7/DJ-1, Tag Free
HA211158-01 20 µg

Human PARK7/DJ-1, Tag Free

Sign In for Pricing
View Details
Human PARK7/DJ-1, Tag Free
HA211158-02 50 µg

Human PARK7/DJ-1, Tag Free

Sign In for Pricing
View Details
Human PARK7/DJ-1, Tag Free
HA211158-03 100 µg

Human PARK7/DJ-1, Tag Free

Sign In for Pricing
View Details