Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTRAF Peptide - C-terminal region

RTRAF Peptide - C-terminal region

Product Specifications

Product Name Alternative

2700060E02Rik

UniProt

Q9CQE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTRAF Rabbit Polyclonal Antibody (orb324787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080804

Preservative

Lyophilized powder

AA Sequence

EKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM4 Mouse Monoclonal Antibody [Clone 2A12]
E45M19917V-2 50 µL

PGAM4 Mouse Monoclonal Antibody [Clone 2A12]

Sign In for Pricing
View Details
PRAT4A Double Nickase Plasmid (h)
sc-404775-NIC 20 µg

PRAT4A Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Recombinant Picea sitchensis CASP-like protein 8
MBS7039206-01 0.02 mg

Recombinant Picea sitchensis CASP-like protein 8

Sign In for Pricing
View Details
Recombinant Picea sitchensis CASP-like protein 8
MBS7039206-02 0.1 mg

Recombinant Picea sitchensis CASP-like protein 8

Sign In for Pricing
View Details
Recombinant Picea sitchensis CASP-like protein 8
MBS7039206-03 5x 0.1 mg

Recombinant Picea sitchensis CASP-like protein 8

Sign In for Pricing
View Details
Canine Tumor necrosis factor Alpha induced protein 8 like protein 1 (TNFAIP8L1) ELISA Kit
GTR10351334 96 Well

Canine Tumor necrosis factor Alpha induced protein 8 like protein 1 (TNFAIP8L1) ELISA Kit

Sign In for Pricing
View Details