Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTRAF Peptide - C-terminal region

RTRAF Peptide - C-terminal region

Product Specifications

Product Name Alternative

2700060E02Rik

UniProt

Q9CQE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTRAF Rabbit Polyclonal Antibody (orb324787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080804

Preservative

Lyophilized powder

AA Sequence

EKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-5'-Oligoadenylate Synthetase 2 (OAS2) Peptide
abx617169 100 µg

2'-5'-Oligoadenylate Synthetase 2 (OAS2) Peptide

Sign In for Pricing
View Details
P53 Antibody (N-Terminal Region)
orb749392-01 20 µg

P53 Antibody (N-Terminal Region)

Sign In for Pricing
View Details
P53 Antibody (N-Terminal Region)
orb749392-02 100 µg

P53 Antibody (N-Terminal Region)

Sign In for Pricing
View Details
SED5 Antibody
orb851261 2 mg

SED5 Antibody

Sign In for Pricing
View Details
Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)
MBS6403489-01 0.1 mL

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)

Sign In for Pricing
View Details
Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)
MBS6403489-02 5x 0.1 mL

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)

Sign In for Pricing
View Details