Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otos Peptide - middle region

Otos Peptide - middle region

Product Specifications

Product Name Alternative

OTOSP

UniProt

Q8R448

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Otos Rabbit Polyclonal Antibody (orb581869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694754

Preservative

Lyophilized powder

AA Sequence

YWPFSTSDFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTLGFHVPYQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubl4b (NM_026261) Mouse Tagged Lenti ORF Clone
MR201772L4 10 µg

Ubl4b (NM_026261) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Penicillin-streptomycin
BS14001C 100 mL

Penicillin-streptomycin

Sign In for Pricing
View Details
Recombinant Shigella flexneri Protein SlyX (slyX)
MBS1328386-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri Protein SlyX (slyX)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Protein SlyX (slyX)
MBS1328386-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri Protein SlyX (slyX)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Protein SlyX (slyX)
MBS1328386-03 0.02 mg (Yeast)

Recombinant Shigella flexneri Protein SlyX (slyX)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Protein SlyX (slyX)
MBS1328386-04 0.1 mg (Yeast)

Recombinant Shigella flexneri Protein SlyX (slyX)

Sign In for Pricing
View Details