Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rangap1 Peptide - N-terminal region

Rangap1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C79654, Fug1, mKIAA1835

UniProt

Q91YS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rangap1 Rabbit Polyclonal Antibody (orb330855) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139646

Preservative

Lyophilized powder

AA Sequence

AAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGIIGTLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2/HER2 (C-Fc-Avi) Biotinylated
PKSH033959-01 20 µg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2/HER2 (C-Fc-Avi) Biotinylated

Sign In for Pricing
View Details
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2/HER2 (C-Fc-Avi) Biotinylated
PKSH033959-02 100 µg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2/HER2 (C-Fc-Avi) Biotinylated

Sign In for Pricing
View Details
R (-) -Gossypol
SIH-223-10MG 10 mg

R (-) -Gossypol

Sign In for Pricing
View Details
ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI3D11]
CF808235 100 µg

ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI3D11]

Sign In for Pricing
View Details
TRAF4 Human Gene Knockout Kit (CRISPR)
KN400345 1 Kit

TRAF4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF594 conjugate, 0.1mg/mL
BNC940774-100 1x 100 µL

HSP27 (HSPB1/774), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details