Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pfkfb4 Peptide - middle region

Pfkfb4 Peptide - middle region

Product Specifications

Product Name Alternative

C230090D14

UniProt

Q6DTY7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pfkfb4 Rabbit Polyclonal Antibody (orb583223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766607

Preservative

Lyophilized powder

AA Sequence

RIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Panx3 Rat shRNA Lentiviral Particle (Locus ID 315567)
TL713786V 500 µL Each

Panx3 Rat shRNA Lentiviral Particle (Locus ID 315567)

Sign In for Pricing
View Details
Recombinant Pongo abelii NADH-ubiquinone oxidoreductase chain 3 (MT-ND3), partial
MBS7056220 Inquire

Recombinant Pongo abelii NADH-ubiquinone oxidoreductase chain 3 (MT-ND3), partial

Sign In for Pricing
View Details
BHMT2 Antibody; Biotin conjugated
MBS7004585-01 0.05 mg

BHMT2 Antibody; Biotin conjugated

Sign In for Pricing
View Details
BHMT2 Antibody; Biotin conjugated
MBS7004585-02 0.1 mg

BHMT2 Antibody; Biotin conjugated

Sign In for Pricing
View Details
BHMT2 Antibody; Biotin conjugated
MBS7004585-03 5x 0.1 mg

BHMT2 Antibody; Biotin conjugated

Sign In for Pricing
View Details
DMAP1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
18304151 3x 1.0 µg DNA

DMAP1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details