Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc27 Peptide - N-terminal region

Dnajc27 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI639580, C330021A05Rik, Rabj, Rbj

UniProt

Q8CFP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc27 Rabbit Polyclonal Antibody (orb583372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694722

Preservative

Lyophilized powder

AA Sequence

DYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Cholinergic Receptor, Nicotinic, Alpha 7 ELISA Kit
MBS080034 Inquire

Rabbit Cholinergic Receptor, Nicotinic, Alpha 7 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal MCPH1 Antibody (OTI2A3) [Alexa Fluor 750]
NBP2-72600AF750 0.1 mL

Mouse Monoclonal MCPH1 Antibody (OTI2A3) [Alexa Fluor 750]

Sign In for Pricing
View Details
Lentiviral mouse Prcp shRNA (UAS) - Lentiviral mouse Prcp shRNA (UAS, GFP) (100)
GTR15168201 1 Vial

Lentiviral mouse Prcp shRNA (UAS) - Lentiviral mouse Prcp shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
KCNMA1/BK channel Rabbit pAb, PerCP-Cy7 conjugated
orb2890018 100 µL

KCNMA1/BK channel Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Human Lumican/LUM (C-6His)
orb1649323-01 10 µg

Recombinant Human Lumican/LUM (C-6His)

Sign In for Pricing
View Details
Recombinant Human Lumican/LUM (C-6His)
orb1649323-02 50 µg

Recombinant Human Lumican/LUM (C-6His)

Sign In for Pricing
View Details