Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc27 Peptide - N-terminal region

Dnajc27 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI639580, C330021A05Rik, Rabj, Rbj

UniProt

Q8CFP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc27 Rabbit Polyclonal Antibody (orb583372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694722

Preservative

Lyophilized powder

AA Sequence

DYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EVI5L Antibody
NBP1-86206-25ul 25 µL

Rabbit Polyclonal EVI5L Antibody

Sign In for Pricing
View Details
MYL3 Antibody (YA4982, Mouse)
HY-P85290 1 Each

MYL3 Antibody (YA4982, Mouse)

Sign In for Pricing
View Details
CYP26A1 Polyclonal Antibody, APC Conjugated
bs-12928R-APC 100 µL

CYP26A1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Chemokine-like receptor 1 (CMKLR1) Antibody
abx210642-01 50 µL

Chemokine-like receptor 1 (CMKLR1) Antibody

Sign In for Pricing
View Details
Chemokine-like receptor 1 (CMKLR1) Antibody
abx210642-02 100 µL

Chemokine-like receptor 1 (CMKLR1) Antibody

Sign In for Pricing
View Details
Anti-Canis Lupus Familiaris NGF Recombinant Antibody (Bedinvetmab)
YR1560-01 1 mg

Anti-Canis Lupus Familiaris NGF Recombinant Antibody (Bedinvetmab)

Sign In for Pricing
View Details