Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aacs Peptide - N-terminal region

Aacs Peptide - N-terminal region

Product Specifications

UniProt

Q9JMI1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aacs Rabbit Polyclonal Antibody (orb584815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EDM13551

Preservative

Lyophilized powder

AA Sequence

MFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Marinum ubiE Protein (aa 1-231)
VAng-Yyj4602-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Marinum ubiE Protein (aa 1-231)

Sign In for Pricing
View Details
pLV2-EF1a-6×His-PTH1R-3×FLAG-Puro Plasmid
PVT46965 2 µg

pLV2-EF1a-6×His-PTH1R-3×FLAG-Puro Plasmid

Sign In for Pricing
View Details
CAST Protein Vector (Rat) (pPM-C-HA)
PV257664 500 ng

CAST Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Clenbuterol Antibody
252327 0.1 mL

Clenbuterol Antibody

Sign In for Pricing
View Details
KY-9
orb1696738 25 mg

KY-9

Sign In for Pricing
View Details
Siglec-10, Human (HEK293, Fc-Avi)
HY-P78516 1 Each

Siglec-10, Human (HEK293, Fc-Avi)

Sign In for Pricing
View Details