Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aacs Peptide - N-terminal region

Aacs Peptide - N-terminal region

Product Specifications

UniProt

Q9JMI1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aacs Rabbit Polyclonal Antibody (orb584815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EDM13551

Preservative

Lyophilized powder

AA Sequence

MFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK4 Antibody
A48127-100UL 100 µL

NEK4 Antibody

Sign In for Pricing
View Details
Ppap2c 3'UTR Luciferase Stable Cell Line
TU116746 1.0 mL

Ppap2c 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phospho-RhoGDI (Ser174) Rabbit pAb
E47R19875 100 µL

Phospho-RhoGDI (Ser174) Rabbit pAb

Sign In for Pricing
View Details
TMEM126A (NM_032273) Human Over-expression Lysate
LS084233-20ug 20 µg

TMEM126A (NM_032273) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GPC1 Pre-designed siRNA Set A
SI006472A 1 Each

Human GPC1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) NANM1 Polyclonal Antibody
MBS9001948 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) NANM1 Polyclonal Antibody

Sign In for Pricing
View Details