Ino80b Peptide - C-terminal region
Ino80b Peptide - C-terminal region
Product Specifications
Product Name Alternative
2510009I23Rik, HMG1YL4, Hmga1l4, Papa1, Znhit4
UniProt
Q99PT3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ino80b Rabbit Polyclonal Antibody (orb584829) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076036
Preservative
Lyophilized powder
AA Sequence
SPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIER
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040774-500 1x 500 µL
HSP27 (HSPB1/774), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680898-100 1x 100 µL
GFAP (GA-5 + ASTRO/789), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RD-WNT10B-Mu-01 96 Tests
Mouse Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit
Sign In for Pricing
View Details