Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbce Peptide - N-terminal region

Tbce Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610206D02Rik, C530005D02Rik, pmn

UniProt

Q8CIV8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbce Rabbit Polyclonal Antibody (orb585103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848027

Preservative

Lyophilized powder

AA Sequence

GLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSFVRPSKVNFGDDFLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sox-18 (h) -PR
sc-36527-PR 10 µM - 20 µL

Sox-18 (h) -PR

Sign In for Pricing
View Details
Talin Rabbit pAb, BF700 conjugated
orb2848130 100 µL

Talin Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
DMP-1 siRNA (h)
sc-72287 10 µM

DMP-1 siRNA (h)

Sign In for Pricing
View Details
Anti-Pembrolizumab Antibody, pAb, Rabbit
A01846-40 40 µg

Anti-Pembrolizumab Antibody, pAb, Rabbit

Sign In for Pricing
View Details
Rabbit anti-Drosophila simulans (Fruit fly) Cyp4d1 Polyclonal Antibody
MBS7180629 Inquire

Rabbit anti-Drosophila simulans (Fruit fly) Cyp4d1 Polyclonal Antibody

Sign In for Pricing
View Details
PDIA5 Antibody
orb2681398-01 50 µL

PDIA5 Antibody

Sign In for Pricing
View Details