Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbce Peptide - N-terminal region

Tbce Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610206D02Rik, C530005D02Rik, pmn

UniProt

Q8CIV8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbce Rabbit Polyclonal Antibody (orb585103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848027

Preservative

Lyophilized powder

AA Sequence

GLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSFVRPSKVNFGDDFLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYN1 (Synapsin-1, Brain Protein 4.1, Synapsin I) discontinued
S9104-04F 100 µg

SYN1 (Synapsin-1, Brain Protein 4.1, Synapsin I) discontinued

Sign In for Pricing
View Details
DCLK2 AAV Vector (Mouse) (CMV)
17731104 1 µg

DCLK2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Gabarap Polyclonal Antibody
CAC07105-01 50 µg

Gabarap Polyclonal Antibody

Sign In for Pricing
View Details
Gabarap Polyclonal Antibody
CAC07105-02 100 µg

Gabarap Polyclonal Antibody

Sign In for Pricing
View Details
TNR (Tenascin-R, TN-R, Janusin, Restrictin) (FITC)
134583-FITC 100 µL

TNR (Tenascin-R, TN-R, Janusin, Restrictin) (FITC)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 21 (FGF21) Protein
abx167639-01 10 µg

Rat Fibroblast Growth Factor 21 (FGF21) Protein

Sign In for Pricing
View Details