Nup160 Peptide - C-terminal region
Nup160 Peptide - C-terminal region
Product Specifications
Product Name Alternative
160kDa, 2810011M03Rik, AA414952, AU020188, Gtl-13, Gtl1-13, Gtl13, KIAA0197, mKIAA0197
UniProt
Q9Z0W3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nup160 Rabbit Polyclonal Antibody (orb585137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067487
Preservative
Lyophilized powder
AA Sequence
WLPYSSIDQLLQALGENSANSHNIILSQKILDKLEDYQQKVDKATRDLLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940683-500 1x 500 µL
Cytokeratin 7 (OV-TL12/30), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940451-100 1x 100 µL
HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details