Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nup160 Peptide - C-terminal region

Nup160 Peptide - C-terminal region

Product Specifications

Product Name Alternative

160kDa, 2810011M03Rik, AA414952, AU020188, Gtl-13, Gtl1-13, Gtl13, KIAA0197, mKIAA0197

UniProt

Q9Z0W3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nup160 Rabbit Polyclonal Antibody (orb585137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067487

Preservative

Lyophilized powder

AA Sequence

WLPYSSIDQLLQALGENSANSHNIILSQKILDKLEDYQQKVDKATRDLLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (OV-TL12/30), CF594 conjugate, 0.1mg/mL
BNC940683-500 1x 500 µL

Cytokeratin 7 (OV-TL12/30), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL
BNC940451-100 1x 100 µL

HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details