Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pitpnc1 Peptide - middle region

Pitpnc1 Peptide - middle region

Product Specifications

Product Name Alternative

1110020B03Rik, 5830436L09Rik, AI662802, AI851387, C330017I21Rik, Dnr411, MGC118005, RDGBB, RDGBB1, rdgB-beta

UniProt

Q8K4R4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pitpnc1 Rabbit Polyclonal Antibody (orb585311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665822

Preservative

Lyophilized powder

AA Sequence

FLPKFSIHIETKYEDNKGSNDSIFDSEAKDLEREVCFIDIACDEIPERYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM39 Polyclonal Antibody
E55A02346 100 µg

RBM39 Polyclonal Antibody

Sign In for Pricing
View Details
Human P2RY1 siRNA
abx903804-01 15 nmol

Human P2RY1 siRNA

Sign In for Pricing
View Details
Human P2RY1 siRNA
abx903804-02 30 nmol

Human P2RY1 siRNA

Sign In for Pricing
View Details
RepuLsive Guidance MolecuLe A (RGMA) (NM_001166287) Human Untagged Clone
SC328715 10 µg

RepuLsive Guidance MolecuLe A (RGMA) (NM_001166287) Human Untagged Clone

Sign In for Pricing
View Details
HIV2 gp120 + gp160 Rabbit pAb
E47R10482 100 µL

HIV2 gp120 + gp160 Rabbit pAb

Sign In for Pricing
View Details
NKG7 Rabbit Polyclonal Antibody (Fluoro488)
orb3093673 100 µg

NKG7 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details