Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SQOR Peptide - C-terminal region

SQOR Peptide - C-terminal region

Product Specifications

Product Name Alternative

Sqrdl, 0610039J17Rik, 4930557M22Rik

UniProt

Q9R112

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SQOR Rabbit Polyclonal Antibody (orb585405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067482

Preservative

Lyophilized powder

AA Sequence

AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Calbindin D-28K Antibody (FGF2/7364) [Alexa Fluor 594]
NBP3-24173AF594 0.1 mL

Mouse Monoclonal Calbindin D-28K Antibody (FGF2/7364) [Alexa Fluor 594]

Sign In for Pricing
View Details
Snrpf Rat shRNA Plasmid (Locus ID 680737)
TR708301 1 Kit

Snrpf Rat shRNA Plasmid (Locus ID 680737)

Sign In for Pricing
View Details
Rat Anti-Human/Mouse Gata-4 Purified (25 ug)
TA320339 25 µg

Rat Anti-Human/Mouse Gata-4 Purified (25 ug)

Sign In for Pricing
View Details
RALGDS Protein Vector (Mouse) (pPM-C-His)
PV222185 500 ng

RALGDS Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ZFP6 Antibody
orb799057 2 mg

ZFP6 Antibody

Sign In for Pricing
View Details
HiCrome® Klebsiella Selective Agar Base
M1573-500G 500 g

HiCrome® Klebsiella Selective Agar Base

Sign In for Pricing
View Details