Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc21 Peptide - middle region

Dnajc21 Peptide - middle region

Product Specifications

Product Name Alternative

4930461P20Rik, 9930116P15Rik

UniProt

E9Q8D0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc21 Rabbit Polyclonal Antibody (orb585425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_084322

Preservative

Lyophilized powder

AA Sequence

FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish TRPM2 Antibody Fluoro647 Conjugated
AZA0A0R4IMY7-Fluoro647 100 µg/Vial

Anti-Zebrafish TRPM2 Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal Ferroportin/SLC40A1 Antibody (1308C) [DyLight 550]
FAB9924L 0.1 mL

Rabbit Monoclonal Ferroportin/SLC40A1 Antibody (1308C) [DyLight 550]

Sign In for Pricing
View Details
Sheep Osteoclast Stimulating Factor 1 ELISA Kit
MBS011031-01 48 Well

Sheep Osteoclast Stimulating Factor 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Osteoclast Stimulating Factor 1 ELISA Kit
MBS011031-02 96 Well

Sheep Osteoclast Stimulating Factor 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Osteoclast Stimulating Factor 1 ELISA Kit
MBS011031-03 5x 96 Well

Sheep Osteoclast Stimulating Factor 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Osteoclast Stimulating Factor 1 ELISA Kit
MBS011031-04 10x 96 Well

Sheep Osteoclast Stimulating Factor 1 ELISA Kit

Sign In for Pricing
View Details