Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc21 Peptide - middle region

Dnajc21 Peptide - middle region

Product Specifications

Product Name Alternative

4930461P20Rik, 9930116P15Rik

UniProt

E9Q8D0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc21 Rabbit Polyclonal Antibody (orb585425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_084322

Preservative

Lyophilized powder

AA Sequence

FYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIRDRARKEKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Bcl2l13 shRNA (UAS) - Lentiviral mouse Bcl2l13 shRNA (UAS) (100)
GTR15207294 1 Vial

Lentiviral mouse Bcl2l13 shRNA (UAS) - Lentiviral mouse Bcl2l13 shRNA (UAS) (100)

Sign In for Pricing
View Details
Jagged 2/JAG2 Rabbit Polyclonal Antibody (Fluoro647)
orb3114059 100 µg

Jagged 2/JAG2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
RPS6KL1 siRNA (m)
sc-153119 10 µM

RPS6KL1 siRNA (m)

Sign In for Pricing
View Details
N- (4-nitrophenyl) urea
sc-354795 1 g

N- (4-nitrophenyl) urea

Sign In for Pricing
View Details
Methoxyphenamine Impurity 5
RM-P083005-01 10 mg

Methoxyphenamine Impurity 5

Sign In for Pricing
View Details
Methoxyphenamine Impurity 5
RM-P083005-02 100 mg

Methoxyphenamine Impurity 5

Sign In for Pricing
View Details