Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPRT Peptide - N-terminal region

NAPRT Peptide - N-terminal region

Product Specifications

Product Name Alternative

Naprt1, 9130210N20Rik

UniProt

Q8CC86

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAPRT Rabbit Polyclonal Antibody (orb585454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766195

Preservative

Lyophilized powder

AA Sequence

RLIAGPDKKLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vertical Autoclave BAVT-302-B
BAVT-302-B 1 Unit

Vertical Autoclave BAVT-302-B

Sign In for Pricing
View Details
Human Osteocrin (OSTN) activation kit by CRISPRa
GA117601 1 Kit

Human Osteocrin (OSTN) activation kit by CRISPRa

Sign In for Pricing
View Details
CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL
BNC941688-100 1x 100 µL

CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2B4 Rabbit Polyclonal Antibody
HA500263 100 µL

2B4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM273 (NM_001288743) Human Tagged ORF Clone
RG236266 10 µg

TMEM273 (NM_001288743) Human Tagged ORF Clone

Sign In for Pricing
View Details
D-Luciferin, SODIUM SALT
#10102 1x 10 mg

D-Luciferin, SODIUM SALT

Sign In for Pricing
View Details