Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPRT Peptide - N-terminal region

NAPRT Peptide - N-terminal region

Product Specifications

Product Name Alternative

Naprt1, 9130210N20Rik

UniProt

Q8CC86

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAPRT Rabbit Polyclonal Antibody (orb585454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766195

Preservative

Lyophilized powder

AA Sequence

RLIAGPDKKLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF405S conjugate, 0.1mg/mL
BNC042682-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perfluorobutylsulphonamide
TRC-P303350-500MG 500 mg

Perfluorobutylsulphonamide

Sign In for Pricing
View Details
CA13 (NM_198584) Human Recombinant Protein
TP720089 10 µg

CA13 (NM_198584) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human MAP1LC3B protein (His tag)
PDEH100753-01 20 µg

Recombinant Human MAP1LC3B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MAP1LC3B protein (His tag)
PDEH100753-02 100 µg

Recombinant Human MAP1LC3B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MAP1LC3B protein (His tag)
PDEH100753-03 500 µg

Recombinant Human MAP1LC3B protein (His tag)

Sign In for Pricing
View Details