Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubb Peptide - N-terminal region

Ubb Peptide - N-terminal region

Product Specifications

Product Name Alternative

AL033289, Rps27a, Uba52, Ubb2, Ubc

UniProt

Q78XY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubb Rabbit Polyclonal Antibody (orb585492) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035794

Preservative

Lyophilized powder

AA Sequence

KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monnieriside G
TN1948-01 1 mg

Monnieriside G

Sign In for Pricing
View Details
Monnieriside G
TN1948-02 5 mg

Monnieriside G

Sign In for Pricing
View Details
Monnieriside G
TN1948-03 1 mL - 10 mM (in DMSO)

Monnieriside G

Sign In for Pricing
View Details
Monnieriside G
TN1948-04 10 mg

Monnieriside G

Sign In for Pricing
View Details
Monnieriside G
TN1948-05 25 mg

Monnieriside G

Sign In for Pricing
View Details
Monnieriside G
TN1948-06 50 mg

Monnieriside G

Sign In for Pricing
View Details