Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubb Peptide - N-terminal region

Ubb Peptide - N-terminal region

Product Specifications

Product Name Alternative

AL033289, Rps27a, Uba52, Ubb2, Ubc

UniProt

Q78XY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubb Rabbit Polyclonal Antibody (orb585492) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035794

Preservative

Lyophilized powder

AA Sequence

KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-ARHGAP11A-sgRNA1-Cas9-Puro Plasmid
PVT84488 2 µg

PLV3-U6-ARHGAP11A-sgRNA1-Cas9-Puro Plasmid

Sign In for Pricing
View Details
Genorise® Biotinylated Guinea Pig BMP3 Polyclonal Antibody
GR213036 50 µg

Genorise® Biotinylated Guinea Pig BMP3 Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Secretory Immunoglobulin A (sIgA) ELISA Kit
RD-sIgA-b-96Tests 96 Tests

Bovine Secretory Immunoglobulin A (sIgA) ELISA Kit

Sign In for Pricing
View Details
TGFB1I1 (ARA55, Transforming Growth Factor beta-1-induced Transcript 1 Protein, Androgen Receptor Coactivator 55kD Protein, Androgen Receptor-associated Protein of 55kD, Hydrogen Peroxide-inducible Clone 5 Protein) (MaxLight 750) discontinued
134381-ML750 100 µL

TGFB1I1 (ARA55, Transforming Growth Factor beta-1-induced Transcript 1 Protein, Androgen Receptor Coactivator 55kD Protein, Androgen Receptor-associated Protein of 55kD, Hydrogen Peroxide-inducible Clone 5 Protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Corpus Cavernosum Endothelial Cells
ARP0789 0.5 Million

Rabbit Corpus Cavernosum Endothelial Cells

Sign In for Pricing
View Details
SLC15A3 Antibody
OACA10228-50UG 50 µg

SLC15A3 Antibody

Sign In for Pricing
View Details