Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sms Peptide - middle region

Sms Peptide - middle region

Product Specifications

Product Name Alternative

AI427066, Gy, SpmST, gyro, SPMSY

UniProt

P97355

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sms Rabbit Polyclonal Antibody (orb326458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033240

Preservative

Lyophilized powder

AA Sequence

IKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)
MBS1039498-01 0.02 mg (E-Coli)

Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)
MBS1039498-02 0.1 mg (E-Coli)

Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)
MBS1039498-03 0.02 mg (Yeast)

Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)
MBS1039498-04 0.1 mg (Yeast)

Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)
MBS1039498-05 0.02 mg (Baculovirus)

Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)
MBS1039498-06 0.02 mg (Mammalian-Cell)

Recombinant Shewanella pealeana Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details