Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angpt1 Peptide - C-terminal region

Angpt1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110046O21Rik, Ang-1, Ang1

UniProt

Q8C2K6

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Angpt1 Rabbit Polyclonal Antibody (orb585529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033770

Preservative

Lyophilized powder

AA Sequence

EFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synpr Antibody
GWB-MV617E 50 µg

Synpr Antibody

Sign In for Pricing
View Details
Slc7a15 Protein Vector (Rat) (pPM-C-HA)
44276026 500 ng

Slc7a15 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)
MBS2098693-01 5x 96 Tests

Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)
MBS2098693-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)
MBS2098693-03 10x 96 Tests

Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)
MBS2098693-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine Cathepsin K (CTSK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details