Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADIPOR1 Peptide - C-terminal region

ADIPOR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACDCR1, CGI-45, CGI45, FLJ25385, FLJ42464, PAQR1, TESBP1A

UniProt

Q96A54

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADIPOR1 Rabbit Polyclonal Antibody (orb585607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057083

Preservative

Lyophilized powder

AA Sequence

FPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1B1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]
TA502550BM 100 µL

ATP6V1B1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details
PCTAIRE3 (CDK18) Rabbit Polyclonal Antibody
TA365870 100 µL

PCTAIRE3 (CDK18) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RIT1 Human Gene Knockout Kit (CRISPR)
KN420552 1 Kit

RIT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmeff2 Mouse Gene Knockout Kit (CRISPR)
KN517688 1 Kit

Tmeff2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mpg Rabbit Polyclonal Antibody
TA362879 100 µL

Mpg Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ApoH Antibody
RC-16695-01 50 μL

Recombinant ApoH Antibody

Sign In for Pricing
View Details