Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADIPOR1 Peptide - C-terminal region

ADIPOR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACDCR1, CGI-45, CGI45, FLJ25385, FLJ42464, PAQR1, TESBP1A

UniProt

Q96A54

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADIPOR1 Rabbit Polyclonal Antibody (orb585607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057083

Preservative

Lyophilized powder

AA Sequence

FPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Myc (MYC) pThr58 Rabbit Polyclonal Antibody
AP01640PU-N 100 µg

c-Myc (MYC) pThr58 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
AP17498PU-N 400 µL

IL1 alpha (IL1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLITRK2 activation kit by CRISPRa
GA113618 1 Kit

Human SLITRK2 activation kit by CRISPRa

Sign In for Pricing
View Details
C12orf48 (PARPBP) Rabbit Polyclonal Antibody
TA361849 100 µL

C12orf48 (PARPBP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Recombinant Mouse Monoclonal Antibody [G3-B11-R]
HA601309 100 µL

STAT1 Recombinant Mouse Monoclonal Antibody [G3-B11-R]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS704314 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details