Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD6 Peptide - C-terminal region

CD6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ44171, TP120

UniProt

P30203

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD6 Rabbit Polyclonal Antibody (orb585608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006716

Preservative

Lyophilized powder

AA Sequence

GPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit
MBS7204777-01 48 Well

Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit

Sign In for Pricing
View Details
Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit
MBS7204777-02 96 Well

Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit

Sign In for Pricing
View Details
Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit
MBS7204777-03 5x 96 Well

Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit

Sign In for Pricing
View Details
Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit
MBS7204777-04 10x 96 Well

Rat PDZ domain-containing protein 11 (PDZD11) ELISA Kit

Sign In for Pricing
View Details
Rat Indoleamine-2,3-Dioxygenase (IDO) ELISA Kit
EK14629 48 Tests

Rat Indoleamine-2,3-Dioxygenase (IDO) ELISA Kit

Sign In for Pricing
View Details
Arginine Esterase, Recombinant, Canine, aa25-260, His-SUMO-Tag
372324-01 20 µg

Arginine Esterase, Recombinant, Canine, aa25-260, His-SUMO-Tag

Sign In for Pricing
View Details