Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD6 Peptide - C-terminal region

CD6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ44171, TP120

UniProt

P30203

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD6 Rabbit Polyclonal Antibody (orb585608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006716

Preservative

Lyophilized powder

AA Sequence

GPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS18 Recombinant Protein (Rat)
RP225944 100 µg

RGS18 Recombinant Protein (Rat)

Sign In for Pricing
View Details
OPRL1 Conjugated Antibody
MBS9448767-01 0.1 mL (Biotin)

OPRL1 Conjugated Antibody

Sign In for Pricing
View Details
OPRL1 Conjugated Antibody
MBS9448767-02 0.1 mL (AF350)

OPRL1 Conjugated Antibody

Sign In for Pricing
View Details
OPRL1 Conjugated Antibody
MBS9448767-03 0.1 mL (AF405)

OPRL1 Conjugated Antibody

Sign In for Pricing
View Details
OPRL1 Conjugated Antibody
MBS9448767-04 0.1 mL (AF488)

OPRL1 Conjugated Antibody

Sign In for Pricing
View Details
OPRL1 Conjugated Antibody
MBS9448767-05 0.1 mL (AF555)

OPRL1 Conjugated Antibody

Sign In for Pricing
View Details