Il15ra Peptide - N-terminal region
Il15ra Peptide - N-terminal region
Product Specifications
Product Name Alternative
AA690181
UniProt
Q60819
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Il15ra Rabbit Polyclonal Antibody (orb585666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032384
Preservative
Lyophilized powder
AA Sequence
NYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940460-100 1x 100 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740270-500 1x 500 µL
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040012-100 1x 100 µL
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040775-500 1x 500 µL
Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details