Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg1 Peptide - middle region

Reg1 Peptide - middle region

Product Specifications

UniProt

Q3TV26

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Reg1 Rabbit Polyclonal Antibody (orb585676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033068

Preservative

Lyophilized powder

AA Sequence

LHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTAP (Tumor Suppressor Marker) (rMTAP/1813), CF647 conjugate, 0.1mg/mL
BNC473646-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (rMTAP/1813), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gamma Sarcoglycan Antibody
KC-2563-01 50 μL

Gamma Sarcoglycan Antibody

Sign In for Pricing
View Details
Gamma Sarcoglycan Antibody
KC-2563-02 100 µL

Gamma Sarcoglycan Antibody

Sign In for Pricing
View Details
Gamma Sarcoglycan Antibody
KC-2563-03 1 mL

Gamma Sarcoglycan Antibody

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL
BNC940752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Czib Mouse Gene Knockout Kit (CRISPR)
KN500010 1 Kit

Czib Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details