Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg1 Peptide - middle region

Reg1 Peptide - middle region

Product Specifications

UniProt

Q3TV26

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Reg1 Rabbit Polyclonal Antibody (orb585676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033068

Preservative

Lyophilized powder

AA Sequence

LHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N,N'-Diisopropylcarbodiimide
TRC-D455495-500MG 500 mg

N,N'-Diisopropylcarbodiimide

Sign In for Pricing
View Details
CDS2 Antibody
KC-41609-01 50 μL

CDS2 Antibody

Sign In for Pricing
View Details
CDS2 Antibody
KC-41609-02 100 µL

CDS2 Antibody

Sign In for Pricing
View Details
CDS2 Antibody
KC-41609-03 1 mL

CDS2 Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (rC31.3), CF647 conjugate, 0.1mg/mL
BNC473462-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (rC31.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kv beta 1 (KCNAB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]
TA503969AM 100 µL

Kv beta 1 (KCNAB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]

Sign In for Pricing
View Details