Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC73 Peptide - C-terminal region

CDC73 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf28, FLJ23316, HPTJT, HRPT2, HYX

UniProt

Q6P1J9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC73 Rabbit Polyclonal Antibody (orb585721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078805

Preservative

Lyophilized powder

AA Sequence

KFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR120 Polyclonal Antibody
MBS8592271-01 0.1 mg

GPR120 Polyclonal Antibody

Sign In for Pricing
View Details
GPR120 Polyclonal Antibody
MBS8592271-02 0.1 mL (AF405L)

GPR120 Polyclonal Antibody

Sign In for Pricing
View Details
GPR120 Polyclonal Antibody
MBS8592271-03 0.1 mL (AF405S)

GPR120 Polyclonal Antibody

Sign In for Pricing
View Details
GPR120 Polyclonal Antibody
MBS8592271-04 0.1 mL (AF610)

GPR120 Polyclonal Antibody

Sign In for Pricing
View Details
GPR120 Polyclonal Antibody
MBS8592271-05 0.1 mL (AF635)

GPR120 Polyclonal Antibody

Sign In for Pricing
View Details
GPR120 Polyclonal Antibody
MBS8592271-06 0.1 mL (APC)

GPR120 Polyclonal Antibody

Sign In for Pricing
View Details