Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCG5 Peptide - C-terminal region

SCG5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

7B2, P7B2, SGNE1, SgV

UniProt

P05408

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCG5 Rabbit Polyclonal Antibody (orb585787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138229

Preservative

Lyophilized powder

AA Sequence

QHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAZ2A Protein Lysate (Mouse) with C-HA Tag
13029034 100 µg

BAZ2A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Gtf2a1 3'UTR Luciferase Stable Cell Line
TU205535 1.0 mL

Gtf2a1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human SART1 MAb (Clone 865709)
MAB8034 100 µg

Human SART1 MAb (Clone 865709)

Sign In for Pricing
View Details
C7ORF72 Protein Vector (Human) (pPM-C-HA)
14708021 500 ng

C7ORF72 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
3′-N3-Ado
BLG-A243-05 5 μmoL

3′-N3-Ado

Sign In for Pricing
View Details
Hecw1 sgRNA CRISPR Lentivector set (Mouse)
K3492401 3x 1.0 µg

Hecw1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details